C20orf172 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human C20orf172 partial ORF ( NP_079194.2, 257 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DSN1
Entrez GeneID
79980GeneBank Accession#
NM_024918Protein Accession#
NP_079194.2Gene Name
DSN1
Gene Alias
C20orf172, FLJ13346, MGC32987, MIS13, dJ469A13.2
Gene Description
DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
Omim ID
609175Gene Ontology
HyperlinkGene Summary
This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
DSN1, MIND kinetochore complex component, homolog|OTTHUMP00000030873
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com