GRHL2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GRHL2.
Immunogen
GRHL2 (NP_079191, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Sequence
ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — GRHL2
Entrez GeneID
79977GeneBank Accession#
NM_024915Protein Accession#
NP_079191Gene Name
GRHL2
Gene Alias
BOM, DFNA28, FLJ11172, FLJ13782, MGC149294, MGC149295, TFCP2L3
Gene Description
grainyhead-like 2 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28)
Other Designations
transcription factor CP2-like 3
-
Disease
-
Publication Reference
-
Grainyhead-like 2 (GRHL2) knockout abolishes oral cancer development through reciprocal regulation of the MAP kinase and TGF-β signaling pathways.
Chen W, Kang KL, Alshaikh A, Varma S, Lin YL, Shin KH, Kim R, Wang CY, Park NH, Walentin K, Schmidt-Ott KM, Kang MK.
Oncogenesis 2018 May; 7(5):38.
Application:IF, WB-Ti, WB-Tr, Human, Mouse, Epidermal tissues, SCC4, BaP-T, SCC9, FaDu, SCC15 cells.
-
hTERT peptide fragment GV1001 demonstrates radioprotective and antifibrotic effects through suppression of TGF-β signaling.
Chen W, Shin KH, Kim S, Shon WJ, Kim RH, Park NH, Kang MK.
International Journal of Molecular Medicine 2018 Jun; 41(6):3211.
Application:WB, Human, Normal human oral keratinocytes (NHOKs).
-
Human Papillomavirus 16 E6 Induces FoxM1B in Oral Keratinocytes through GRHL2.
Chen W, Shimane T, Kawano S, Alshaikh A, Kim SY, Chung SH, Kim RH, Shin KH, Walentin K, Park NH, Schmidt-Ott KM, Kang MK.
Journal of Dental Research 2018 Feb; 22034518756071.
Application:WB, Human, Normal human oral keratinocytes (NHOKs), HOK-16B, OSCC cells.
-
Grainyhead-like 2 regulates epithelial plasticity and stemness in oral cancer cells.
Chen W, Yi JK, Shimane T, Mehrazarin S, Lin YL, Shin KH, Kim RH, Park NH, Kang MK.
Carcinogenesis 2016 Mar; 37(5):500.
Application:WB, IHC, Human, Primary normal human oral keratinocytes, HOK-16B and OSCC cell lines (HOK-16B/BaP-T and SCC15), P19 embryonic carcinoma cell line.
-
Dual Roles of the Transcription Factor Grainyhead-like 2 (GRHL2) in Breast Cancer.
Werner S, Frey S, Riethdorf S, Schulze C, Alawi M, Kling L, Vafaizadeh V, Sauter G, Terracciano L, Schumacher U, Pantel K, Assmann V.
The Journal of Biological Chemistry 2013 Aug; 288(32):22993.
Application:ChIP, Mouse, NIH/3T3 cells.
-
Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism.
Chen W, Xiao Liu Z, Oh JE, Shin KH, Kim RH, Jiang M, Park NH, Kang MK.
Cell Death & Disease 2012 Dec; 3:e450.
Application:WB, Human, Keratinocyte, HaCaT cell.
-
Grainyhead-like 2 Enhances the Human Telomerase Reverse Transcriptase Gene Expression by Inhibiting DNA Methylation at the 5'-CpG Island in Normal Human Keratinocytes.
Chen W, Dong Q, Shin KH, Kim RH, Oh JE, Park NH, Kang MK.
The Journal of Biological Chemistry 2010 Dec; 285(52):40852.
Application:WB, Human, NHOK, NHEK.
-
Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.
Kang X, Chen W, Kim RH, Kang MK, Park NH.
Oncogene 2008 Nov; 28(4):565.
Application:ChIP, WB-Ce, Human, NHOK and OSCC cell lines 1483, BaP-T, FaDu, HEp-2, SCC4, SCC15 cells.
-
Grainyhead-like 2 (GRHL2) knockout abolishes oral cancer development through reciprocal regulation of the MAP kinase and TGF-β signaling pathways.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com