THNSL1 monoclonal antibody (M08), clone 6B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
THNSL1 monoclonal antibody (M08), clone 6B1 Western Blot analysis of THNSL1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of THNSL1 expression in transfected 293T cell line by THNSL1 monoclonal antibody (M08), clone 6B1.
Lane 1: THNSL1 transfected lysate(83.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged THNSL1 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of THNSL1 over-expressed 293 cell line, cotransfected with THNSL1 Validated Chimera RNAi ( Cat # H00079896-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with THNSL1 monoclonal antibody (M08), clone 6B1 (Cat # H00079896-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant THNSL1.
Immunogen
THNSL1 (NP_079114, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IVYLDVPLLDLICRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAIKRYQDVDSETFISTRHVWPEDCEQKVSAKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
THNSL1 monoclonal antibody (M08), clone 6B1 Western Blot analysis of THNSL1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of THNSL1 expression in transfected 293T cell line by THNSL1 monoclonal antibody (M08), clone 6B1.
Lane 1: THNSL1 transfected lysate(83.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged THNSL1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of THNSL1 over-expressed 293 cell line, cotransfected with THNSL1 Validated Chimera RNAi ( Cat # H00079896-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with THNSL1 monoclonal antibody (M08), clone 6B1 (Cat # H00079896-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — THNSL1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com