Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALG13 (Human) Recombinant Protein (P01)

  • Catalog # : H00079868-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ALG13 full-length ORF ( NP_060936.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079868-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Protein Array
  • Gene Information
  • Gene Name:
  • ALG13
  • Gene Alias:
  • CXorf45,FLJ23018,GLT28D1,MDS031,MGC12423,YGL047W
  • Gene Description:
  • asparagine-linked glycosylation 13 homolog (S. cerevisiae)
  • Gene Summary:
  • Asparagine (N)-glycosylation is an essential modification that regulates protein folding and stability. ALG13 and ALG14 (MIM 612866) constitute the UDP-GlcNAc transferase, which catalyzes a key step in endoplasmic reticulum N-linked glycosylation (Averbeck et al., 2007 [PubMed 17686769]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000062812,OTTHUMP00000176862,asparagine-linked glycosylation 13 homolog,glycosyltransferase 28 domain containing 1,hematopoietic stem/progenitor cells protein MDS031
  • RSS
  • YouTube
  • Linkedin
  • Facebook