Product Browser

Last updated: 2017/11/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALG13 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00079868-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ALG13 protein.
  • Immunogen:
  • ALG13 (NP_060936, 1 a.a. ~ 165 a.a) full-length human protein.
  • Sequence:
  • MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ALG13 expression in transfected 293T cell line by ALG13 MaxPab polyclonal antibody.

    Lane 1: ALG13 transfected lysate(18.15 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ALG13
  • Gene Alias:
  • CXorf45,FLJ23018,GLT28D1,MDS031,MGC12423,YGL047W
  • Gene Description:
  • asparagine-linked glycosylation 13 homolog (S. cerevisiae)
  • Gene Summary:
  • Asparagine (N)-glycosylation is an essential modification that regulates protein folding and stability. ALG13 and ALG14 (MIM 612866) constitute the UDP-GlcNAc transferase, which catalyzes a key step in endoplasmic reticulum N-linked glycosylation (Averbeck et al., 2007 [PubMed 17686769]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000062812,OTTHUMP00000176862,asparagine-linked glycosylation 13 homolog,glycosyltransferase 28 domain containing 1,hematopoietic stem/progenitor cells protein MDS031
  • RSS
  • YouTube
  • Linkedin
  • Facebook