Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RNF127 (Human) Recombinant Protein (Q01)

  • Catalog # : H00079836-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RNF127 partial ORF ( NP_079054, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079836-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LONRF3
  • Gene Alias:
  • FLJ22612,MGC119463,MGC119465,RNF127
  • Gene Description:
  • LON peptidase N-terminal domain and ring finger 3
  • Gene Summary:
  • The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023893,ring finger protein 127
  • RSS
  • YouTube
  • Linkedin
  • Facebook