Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MOBKL2B (Human) Recombinant Protein (P01)

  • Catalog # : H00079817-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MOBKL2B full-length ORF ( NP_079037.3, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079817-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MOBKL2B
  • Gene Alias:
  • FLJ13204,FLJ23916,MGC32960,MOB3B
  • Gene Description:
  • MOB1, Mps One Binder kinase activator-like 2B (yeast)
  • Gene Summary:
  • The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the interferon kappa precursor (IFNK) gene. [provided by RefSeq
  • Other Designations:
  • MOB1, Mps One Binder kinase activator-like 2B,OTTHUMP00000021173,monopolar spindle 1 binding, MOB1, domain containing
  • RSS
  • YouTube
  • Linkedin
  • Facebook