Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HPS6 polyclonal antibody (A01)

  • Catalog # : H00079803-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HPS6.
  • Immunogen:
  • HPS6 (NP_079023, 400 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00079803-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HPS6
  • Gene Alias:
  • FLJ22501,MGC20522,RP11-302K17.1
  • Gene Description:
  • Hermansky-Pudlak syndrome 6
  • Gene Summary:
  • This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq
  • Other Designations:
  • Hermansky-Pudlak syndrome-6,Hermansky-Pudlak syndrome-6 protein (HPS6)
  • RSS
  • YouTube
  • Linkedin
  • Facebook