FBXO31 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FBXO31 protein.
Immunogen
FBXO31 (AAH12748.1, 1 a.a. ~ 367 a.a) full-length human protein.
Sequence
MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FBXO31 expression in transfected 293T cell line (H00079791-T01) by FBXO31 MaxPab polyclonal antibody.
Lane 1: FBXO31 transfected lysate(40.37 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FBXO31 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FBXO31
Entrez GeneID
79791GeneBank Accession#
BC012748.1Protein Accession#
AAH12748.1Gene Name
FBXO31
Gene Alias
DKFZp434B027, DKFZp434J1815, FBX14, FBXO14, FLJ22477, Fbx31, MGC15419, MGC9527, pp2386
Gene Description
F-box protein 31
Omim ID
609102Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXO31, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
F-box only protein 31|SCF ubiquitin ligase specificity factor|putative breast cancer tumor-suppressor
-
Interactome
-
Publication Reference
-
FBXO31 suppresses lipogenesis and tumor progression in glioma by promoting ubiquitination and degradation of CD147.
Yan Feng, Mingli Liu, Peng Xie, Ruifeng Dong, Zhongfei Hao.
Prostaglandins & other Lipid Mediators 2022 Aug; 163:106667.
Application:WB-Ce, WB-Tr, Human, A172, BT-325, Human glioma tumor tissue, HEB, LN-229, T98G, U251MG..
-
Concomitant beige adipocyte differentiation upon induction of mesenchymal stem cells into brown adipocytes.
Wang YL, Lin SP, Hsieh PC, Hung SC.
Biochemical and Biophysical Research Communications 2016 Sep; 478(2):689.
Application:WB-Ce, Human, Mesenchymal stem cells.
-
FBXO31 suppresses lipogenesis and tumor progression in glioma by promoting ubiquitination and degradation of CD147.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com