GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GEMIN7 MaxPab rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T03) by GEMIN7 MaxPab polyclonal antibody.
Lane 1: GEMIN7 transfected lysate(14.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GEMIN7 on HeLa cell. [antibody concentration 20 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GEMIN7 protein.
Immunogen
GEMIN7 (NP_001007270.1, 1 a.a. ~ 131 a.a) full-length human protein.
Sequence
MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GEMIN7 MaxPab rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T03) by GEMIN7 MaxPab polyclonal antibody.
Lane 1: GEMIN7 transfected lysate(14.50 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to GEMIN7 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — GEMIN7
Entrez GeneID
79760GeneBank Accession#
NM_001007269.1Protein Accession#
NP_001007270.1Gene Name
GEMIN7
Gene Alias
SIP3
Gene Description
gem (nuclear organelle) associated protein 7
Omim ID
607419Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
gemin 7
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com