Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GEMIN7 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00079760-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GEMIN7 protein.
  • Immunogen:
  • GEMIN7 (NP_001007270.1, 1 a.a. ~ 131 a.a) full-length human protein.
  • Sequence:
  • MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • GEMIN7 MaxPab rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T03) by GEMIN7 MaxPab polyclonal antibody.

    Lane 1: GEMIN7 transfected lysate(14.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GEMIN7
  • Gene Alias:
  • SIP3
  • Gene Description:
  • gem (nuclear organelle) associated protein 7
  • Gene Summary:
  • The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • gemin 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook