Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GEMIN7 MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00079760-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GEMIN7 protein.
  • Immunogen:
  • GEMIN7 (NP_001007270.1, 1 a.a. ~ 131 a.a) full-length human protein.
  • Sequence:
  • MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GEMIN7 expression in transfected 293T cell line (H00079760-T02) by GEMIN7 MaxPab polyclonal antibody.

    Lane 1: GEMIN7 transfected lysate(14.41 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GEMIN7
  • Gene Alias:
  • SIP3
  • Gene Description:
  • gem (nuclear organelle) associated protein 7
  • Gene Summary:
  • The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • gemin 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook