- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
GEMIN7 polyclonal antibody (A01)
- Catalog # : H00079760-A01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 uL
- USD $ 229
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a full-length recombinant GEMIN7.
- Immunogen:
- GEMIN7 (AAH07793, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag.
- Sequence:
- MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.52 KDa) .
- Storage Buffer:
- 50 % glycerol
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Role of survival motor neuron complex components in small nuclear ribonucleoprotein assembly.
Ogawa C, Usui K, Ito F, Itoh M, Hayashizaki Y, Suzuki H.J Biol Chem. 2009 May 22;284(21):14609-17. Epub 2009 Mar 25.
- 2.
- Gemin2 plays an important role in stabilizing the survival of motor neuron complex.
Ogawa C, Usui K, Aoki M, Ito F, Itoh M, Kai C, Kanamori-Katayama M, Hayashizaki Y, Suzuki H.J Biol Chem. 2007 Apr 13;282(15):11122-34. Epub 2007 Feb 16.
- Application Image
- Western Blot (Recombinant protein)
- ELISA
- Entrez GeneID:
- 79760
- GeneBank Accession#:
- BC007793
- Protein Accession#:
- AAH07793
- Gene Name:
- GEMIN7
- Gene Alias:
- SIP3
- Gene Description:
- gem (nuclear organelle) associated protein 7
- Omim ID:
- 607419
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
- Other Designations:
- gemin 7
