Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASB13 (Human) Recombinant Protein (P01)

  • Catalog # : H00079754-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ASB13 full-length ORF ( NP_078977.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 56.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079754-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ASB13
  • Gene Alias:
  • FLJ13134,MGC19879
  • Gene Description:
  • ankyrin repeat and SOCS box-containing 13
  • Gene Summary:
  • The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length sequences are not known. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019006,ankyrin repeat and SOCS box-containing protein 13,ankyrin repeat domain-containing SOCS box protein Asb-13
  • RSS
  • YouTube
  • Linkedin
  • Facebook