SMC6L1 monoclonal antibody (M01), clone 2E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMC6L1.
Immunogen
SMC6L1 (AAH39828, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMC6L1 monoclonal antibody (M01), clone 2E6. Western Blot analysis of SMC6 expression in A-431.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SMC6L1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — SMC6
Entrez GeneID
79677GeneBank Accession#
BC039828Protein Accession#
AAH39828Gene Name
SMC6
Gene Alias
FLJ22116, FLJ35534, SMC6L1
Gene Description
structural maintenance of chromosomes 6
Omim ID
609387Gene Ontology
HyperlinkOther Designations
OTTHUMP00000115843|SMC6 protein|SMC6 structural maintenance of chromosomes 6-like 1
-
Interactome
-
Disease
-
Publication Reference
-
In-frame deletion of SMC5 related with the phenotype of primordial dwarfism, chromosomal instability and insulin resistance.
Wenjiao Zhu, Yuanping Shi, Changrun Zhang, Yajie Peng, Yueyue Wan, Yue Xu, Xuemeng Liu, Bing Han, Shuangxia Zhao, Yanping Kuang, Huaidong Song, Jie Qiao.
Clinical and Translational Medicine 2023 Jan; 13(1):e1007.
Application:WB-Ti, Human, Human fibroblasts.
-
Smc5/6-mediated regulation of replication progression contributes to chromosome assembly during mitosis in human cells.
Gallego-Paez LM, Tanaka H, Bando M, Takahashi M, Nozaki N, Nakato R, Shirahige K, Hirota T.
Molecular Biology of the Cell 2014 Jan; 25(2):302.
Application:ChIP, IP, Human, HeLa cells.
-
In-frame deletion of SMC5 related with the phenotype of primordial dwarfism, chromosomal instability and insulin resistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com