Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R3B (Human) Recombinant Protein (P01)

  • Catalog # : H00079660-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PPP1R3B full-length ORF ( AAH43388, 1 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 57.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079660-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PPP1R3B
  • Gene Alias:
  • FLJ14005,FLJ34675,GL,PPP1R4
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 3B
  • Gene Summary:
  • The protein phosphatase-1 (PP1) catalytic subunit (PPP1CA; MIM 176875) is regulated by targeting subunits, such as PP1R3B. PP1R3B suppresses the rate at which PP1 dephosphorylates (i.e., inactivates) glycogen phosphorylase (see PYGL; MIM 232700) and enhances the rate at which it activates glycogen synthase (see GYS2; MIM 138571) (Doherty et al., 1995 [PubMed 7498521]).[supplied by OMIM
  • Other Designations:
  • -
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook