Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLJ13154 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00079650-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FLJ13154 protein.
  • Immunogen:
  • FLJ13154 (AAH04415, 1 a.a. ~ 265 a.a) full-length human protein.
  • Sequence:
  • MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGSEDAEVLLRVHTEQVRCKSGNKFFSMPLK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of C16orf57 expression in transfected 293T cell line (H00079650-T01) by C16orf57 MaxPab polyclonal antibody.

    Lane 1: FLJ13154 transfected lysate(29.26 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • C16orf57
  • Gene Alias:
  • FLJ13154,HVSL1
  • Gene Description:
  • chromosome 16 open reading frame 57
  • Other Designations:
  • HVSL motif containing 1,hypothetical protein LOC79650
  • RSS
  • YouTube
  • Linkedin
  • Facebook