RIC3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RIC3 expression in transfected 293T cell line (H00079608-T01) by RIC3 MaxPab polyclonal antibody.
Lane 1: RIC3 transfected lysate(41.1 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RIC3 protein.
Immunogen
RIC3 (NP_078833.2, 1 a.a. ~ 368 a.a) full-length human protein.
Sequence
MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RIC3 expression in transfected 293T cell line (H00079608-T01) by RIC3 MaxPab polyclonal antibody.
Lane 1: RIC3 transfected lysate(41.1 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RIC3
Entrez GeneID
79608GeneBank Accession#
NM_024557Protein Accession#
NP_078833.2Gene Name
RIC3
Gene Alias
AYST720, FLJ11608, PRO1385
Gene Description
resistance to inhibitors of cholinesterase 3 homolog (C. elegans)
Omim ID
610509Gene Ontology
HyperlinkGene Summary
RIC3 is a protein associated with nicotinic acetylcholine receptors (nAChRs), neurotransmitter-gated ion channels expressed at the neuromuscular junction and within the central and peripheral nervous systems, that can enhance functional expression of multiple nAChR subtypes (Lansdell et al., 2005 [PubMed 16120769]).[supplied by OMIM
Other Designations
resistance to inhibitors of cholinesterase 3 homolog
-
Interactome
-
Disease
-
Publication Reference
-
Binding motif for RIC-3 chaperon protein in serotonin type 3A receptors.
Hoa Quynh Do, Michaela Jansen.
The Journal of General Physiology 2023 Jun; 155(6):e202213305.
Application：WB-Ti, Frog, Frog oocytes.
-
Binding motif for RIC-3 chaperon protein in serotonin type 3A receptors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com