KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KREMEN2 expression in transfected 293T cell line (H00079412-T01) by KREMEN2 MaxPab polyclonal antibody.
Lane1:KREMEN2 transfected lysate(46.2 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human KREMEN2 protein.
Immunogen
KREMEN2 (NP_078783.1, 1 a.a. ~ 420 a.a) full-length human protein.
Sequence
MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KREMEN2 expression in transfected 293T cell line (H00079412-T01) by KREMEN2 MaxPab polyclonal antibody.
Lane1:KREMEN2 transfected lysate(46.2 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — KREMEN2
Entrez GeneID
79412GeneBank Accession#
NM_024507Protein Accession#
NP_078783.1Gene Name
KREMEN2
Gene Alias
KRM2, MGC10791, MGC16709
Gene Description
kringle containing transmembrane protein 2
Omim ID
609899Gene Ontology
HyperlinkGene Summary
This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq
Other Designations
kringle-containing transmembrane protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com