IRX1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant IRX1.
Immunogen
IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag.
Sequence
NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.27 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IRX1 polyclonal antibody (A01), Lot # 051025JC01 Western Blot analysis of IRX1 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — IRX1
Entrez GeneID
79192GeneBank Accession#
NM_024337Protein Accession#
NP_077313Gene Name
IRX1
Gene Alias
IRX-5, IRXA1
Gene Description
iroquois homeobox 1
Omim ID
606197Gene Ontology
HyperlinkGene Summary
IRX1 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM
Other Designations
iroquois homeobox protein 1
-
Disease
-
Publication Reference
-
H. pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.
Guo XB, Guo L, Zhi QM, Ji J, Jiang JL, Zhang RJ, Zhang JN, Zhang J, Chen XH, Cai Q, Li JF, Yan M, Gu QL, Liu BY, Zhu ZG, Yu YY.
Journal of Gastroenterology and Hepatology 2011 Nov; 26(11):1685.
Application:WB-Ce, Human, GES-1 cells.
-
Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
Zougman A, Mann M, Wisniewski JR.
Nucleic Acids Research 2011 Sep; 39(16):7103.
-
Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.
Guo X, Liu W, Pan Y, Ni P, Ji J, Guo L, Zhang J, Wu J, Jiang J, Chen X, Cai Q, Li J, Zhang J, Gu Q, Liu B, Zhu Z, Yu Y.
Oncogene 2010 Jul; 29(27):3908.
Application:ICC, WB, Human, SGC-7901 cells.
-
H. pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com