Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LENG4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00079143-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LENG4 partial ORF ( NP_077274.2, 96 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00079143-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MBOAT7
  • Gene Alias:
  • BB1,LENG4,LPIAT,hMBOA-7
  • Gene Description:
  • membrane bound O-acyltransferase domain containing 7
  • Gene Summary:
  • This gene encodes a member of the membrane-bound O-acyltransferases family of integral membrane proteins that have acyltransferase activity. The encoded protein is a lysophosphatidylinositol acyltransferase that has specificity for arachidonoyl-CoA as an acyl donor. This protein is involved in the reacylation of phospholipids as part of the phospholipid remodeling pathway known as the Land cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000069334,leukocyte receptor cluster (LRC) member 4,leukocyte receptor cluster (LRC) member 4 protein,lysophosphatidylinositol acyltransferase,malignant cell expression-enhanced gene/tumor progression-enhanced
  • RSS
  • YouTube
  • Linkedin
  • Facebook