Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALG12 polyclonal antibody (A01)

  • Catalog # : H00079087-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ALG12.
  • Immunogen:
  • ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00079087-A01
    Western Blot detection against Immunogen (32.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ALG12
  • Gene Alias:
  • ECM39,MGC111358,MGC3136,PP14673,hALG12
  • Gene Description:
  • asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq
  • Other Designations:
  • alpha-1,6-mannosyltransferase ALG12,asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase),asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase),dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-a
  • RSS
  • YouTube
  • Linkedin
  • Facebook