FTO (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FTO full-length ORF ( AAH01284.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNLCLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.8
Interspecies Antigen Sequence
Mouse (20); Rat (20)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FTO
Entrez GeneID
79068GeneBank Accession#
BC001284.1Protein Accession#
AAH01284.1Gene Name
FTO
Gene Alias
KIAA1752, MGC5149
Gene Description
fat mass and obesity associated
Gene Ontology
HyperlinkGene Summary
The exact function of this gene is not know. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- Anorexia Nervosa
- Appetite
- Asthma
- Atherosclerosis
- Birth Weight
- Calcinosis
- Carcinoma
- Cardiovascular Diseases
- Cataract
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com