SECISBP2 monoclonal antibody (M08), clone 3A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SECISBP2 expression in transfected 293T cell line by SECISBP2 monoclonal antibody (M08), clone 3A7.
Lane 1: SECISBP2 transfected lysate (Predicted MW: 95.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SECISBP2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SECISBP2.
Immunogen
SECISBP2 (NP_076982.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRII
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SECISBP2 expression in transfected 293T cell line by SECISBP2 monoclonal antibody (M08), clone 3A7.
Lane 1: SECISBP2 transfected lysate (Predicted MW: 95.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SECISBP2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SECISBP2
Entrez GeneID
79048GeneBank Accession#
NM_024077Protein Accession#
NP_076982.3Gene Name
SECISBP2
Gene Alias
DKFZp686C09169, SBP2
Gene Description
SECIS binding protein 2
Gene Ontology
HyperlinkGene Summary
The incorporation of selenocysteine into a protein requires the concerted action of an mRNA element called a sec insertion sequence (SECIS), a selenocysteine-specific translation elongation factor and a SECIS binding protein. With these elements in place, a UGA codon can be decoded as selenocysteine. The gene described in this record encodes a nuclear protein that functions as a SECIS binding protein. Mutations in this gene have been associated with a reduction in activity of a specific thyroxine deiodinase, a selenocysteine-containing enzyme, and abnormal thyroid hormone metabolism. [provided by RefSeq
Other Designations
OTTHUMP00000021618|OTTHUMP00000064929|OTTHUMP00000064930|OTTHUMP00000064931|OTTHUMP00000064932|selenocysteine insertion sequence binding protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com