Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSEN34 polyclonal antibody (A01)

  • Catalog # : H00079042-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TSEN34.
  • Immunogen:
  • TSEN34 (NP_076980, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00079042-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TSEN34 polyclonal antibody (A01), Lot # 060608JCS1 Western Blot analysis of TSEN34 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TSEN34
  • Gene Alias:
  • LENG5,PCH2C,SEN34,SEN34L
  • Gene Description:
  • tRNA splicing endonuclease 34 homolog (S. cerevisiae)
  • Gene Summary:
  • tRNA splicing is a fundamental process required for cell growth and division. SEN34 is a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns, the first step in tRNA splicing (Paushkin et al., 2004 [PubMed 15109492]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000069331,leukocyte receptor cluster (LRC) member 5,tRNA splicing endonuclease 34 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook