AHNAK monoclonal antibody (M01), clone 3G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AHNAK.
Immunogen
AHNAK (NP_076965, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AHNAK expression in transfected 293T cell line by AHNAK monoclonal antibody (M01), clone 3G7.
Lane 1: AHNAK transfected lysate(16 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of AHNAK transfected lysate using anti-AHNAK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHNAK MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AHNAK is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — AHNAK
-
Interactome
-
Publication Reference
-
Proteomic investigation of the interactome of FMNL1 in hematopoietic cells unveils a role in calcium-dependent membrane plasticity.
Han Y, Yu G, Sarioglu H, Caballero-Martinez A, Schlott F, Ueffing M, Haase H, Peschel C, Krackhardt AM.
Journal of Proteomics 2013 Jan; 78:72.
Application:IF, WB-Ce, Human, T, K562 cells.
-
Ahnak1 interaction is affected by phosphorylation of Ser-296 on Cavβ₂.
Pankonien I, Otto A, Dascal N, Morano I, Haase H.
Biochemical and Biophysical Research Communications 2012 May; 421(2):184.
Application:IF, Mouse, Ventricular myocytes.
-
Ahnak1 abnormally localizes in muscular dystrophies and contributes to muscle vesicle release.
Zacharias U, Purfurst B, Schowel V, Morano I, Spuler S, Haase H.
Journal of Muscle Research and Cell Motility 2011 Dec; 32(4-5):271.
Application:IF, IHC-Fr, Human, Human muscles.
-
The C type natriuretic peptide receptor tethers AHNAK1 at the plasma membrane to potentiate arachidonic acid induced calcium mobilization.
Alli AA, Gower WR Jr.
American Journal of Physiology. Cell Physiology 2009 Nov; 297(5):C1157.
Application:WB, Human, Mouse, 3T3-L1, AoSMC, HeLa, RGM1 cells.
-
Searching for new biomarkers of bladder cancer based on proteomic analysis.
Okusa H, Kodera Y, Oh-Ishi M, MinamidaY, Tsuchida M, Kavoussi N, Matsumoto K, Sato T, Iwamura M, Maeda Y, Baba S.
Journal of Electrophoresis 2008 Mar; 52(1):19.
Application:IHC, WB-Ti, Human, Human bladder carcinoma.
-
Proteomic investigation of the interactome of FMNL1 in hematopoietic cells unveils a role in calcium-dependent membrane plasticity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com