COLEC11 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human COLEC11 full-length ORF ( NP_076932.1, 1 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
55.1
Interspecies Antigen Sequence
Mouse (91); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — COLEC11
Entrez GeneID
78989GeneBank Accession#
NM_024027.3Protein Accession#
NP_076932.1Gene Name
COLEC11
Gene Alias
CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1, DKFZp686N1868, MGC3279
Gene Description
collectin sub-family member 11
Gene Ontology
HyperlinkGene Summary
COLEC11 is a member of the collectin family of C-type lectins, which contain a collagen-like domain and a carbohydrate recognition domain, and play a role in host-defense (Keshi et al., 2006 [PubMed 17179669]).[supplied by OMIM
Other Designations
collectin kidney I
-
Interactomes
-
Diseases
-
Publication Reference
-
COLEC10 is mutated in 3MC patients and regulates early craniofacial development.
Munye MM, Diaz-Font A, Ocaka L, Henriksen ML, Lees M, Brady A, Jenkins D, Morton J, Hansen SW, Bacchelli C, Beales PL, Hernandez-Hernandez V.
PLoS Genetics 2017 Mar; 13(3):e1006679.
Application:Func, Human, HeLa cells.
-
COLEC10 is mutated in 3MC patients and regulates early craniofacial development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com