Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRELD1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00078987-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRELD1 partial ORF ( NP_056328.2, 245 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00078987-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CRELD1
  • Gene Alias:
  • AVSD2,CIRRIN,DKFZp566D213
  • Gene Description:
  • cysteine-rich with EGF-like domains 1
  • Gene Summary:
  • Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000158826,atrioventricular septal defect 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook