Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUSP26 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00078986-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DUSP26 protein.
  • Immunogen:
  • DUSP26 (NP_076930.1, 1 a.a. ~ 211 a.a) full-length human protein.
  • Sequence:
  • MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DUSP26 expression in transfected 293T cell line (H00078986-T01) by DUSP26 MaxPab polyclonal antibody.

    Lane 1: DUSP26 transfected lysate(23.21 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DUSP26
  • Gene Alias:
  • DUSP24,LDP-4,MGC1136,MGC2627,MKP8,NATA1,SKRP3
  • Gene Description:
  • dual specificity phosphatase 26 (putative)
  • Other Designations:
  • Novel amplified gene in thyroid anaplastic cancer,dual specificity phosphatase 26,dual-specificity phosphatase SKRP3,low-molecular-mass dual-specificity phosphatase 4,mitogen-activated protein kinase phosphatase 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook