BOLL MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
BOLL MaxPab rabbit polyclonal antibody. Western Blot analysis of BOLL expression in mouse testis.
Western Blot (Transfected lysate)
Western Blot analysis of BOLL expression in transfected 293T cell line (H00066037-T02) by BOLL MaxPab polyclonal antibody.
Lane 1: BOLL transfected lysate(32.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BOLL transfected lysate using anti-BOLL MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with BOLL MaxPab mouse polyclonal antibody (B01) (H00066037-B01).
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to BOLL on HeLa cell. [antibody concentration 30 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BOLL protein.
Immunogen
BOLL (NP_932074.1, 1 a.a. ~ 295 a.a) full-length human protein.
Sequence
METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BOLL MaxPab rabbit polyclonal antibody. Western Blot analysis of BOLL expression in mouse testis.Western Blot (Transfected lysate)
Western Blot analysis of BOLL expression in transfected 293T cell line (H00066037-T02) by BOLL MaxPab polyclonal antibody.
Lane 1: BOLL transfected lysate(32.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BOLL transfected lysate using anti-BOLL MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with BOLL MaxPab mouse polyclonal antibody (B01) (H00066037-B01).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to BOLL on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — BOLL
Entrez GeneID
66037GeneBank Accession#
NM_197970.1Protein Accession#
NP_932074.1Gene Name
BOLL
Gene Alias
-
Gene Description
bol, boule-like (Drosophila)
Omim ID
606165Gene Ontology
HyperlinkGene Summary
This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
boule
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com