Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FUNDC2 monoclonal antibody (M05), clone 2G12

  • Catalog # : H00065991-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FUNDC2.
  • Immunogen:
  • FUNDC2 (NP_076423, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLFIGGVTGWCTGFI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00065991-M05
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FUNDC2 monoclonal antibody (M05), clone 2G12. Western Blot analysis of FUNDC2 expression in human kidney.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • FUNDC2
  • Gene Alias:
  • DC44,FLJ33773,HCBP6,HCC3,MGC131676,MGC2495,PD03104
  • Gene Description:
  • FUN14 domain containing 2
  • Other Designations:
  • OTTHUMP00000015441,OTTHUMP00000061459,cervical cancer oncogene 3,hepatitis C virus core-binding protein 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook