WNK2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WNK2 partial ORF ( NP_006639, 2118 a.a. - 2217 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPDPESEKPD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (75); Rat (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WNK2
Entrez GeneID
65268GeneBank Accession#
NM_006648Protein Accession#
NP_006639Gene Name
WNK2
Gene Alias
KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43
Gene Description
WNK lysine deficient protein kinase 2
Omim ID
606249Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic serine-threonine kinase that contains cysteine in place of the lysine found at the conserved ATP-binding location in subdomain II of protein kinases. Since this protein does have kinase activity, it is possible that another lysine in the kinase subdomain I can substitute for the missing conserved lysine. [provided by RefSeq
Other Designations
mitogen-activated protein kinase kinase kinase|protein kinase, lysine deficient 2|serologically defined colon cancer antigen 43
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com