WNK2 monoclonal antibody (M01), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WNK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WNK2 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WNK2.
Immunogen
WNK2 (NP_006639, 2118 a.a. ~ 2217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPDPESEKPD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WNK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WNK2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — WNK2
Entrez GeneID
65268GeneBank Accession#
NM_006648Protein Accession#
NP_006639Gene Name
WNK2
Gene Alias
KIAA1760, NY-CO-43, P/OKcl.13, PRKWNK2, SDCCAG43
Gene Description
WNK lysine deficient protein kinase 2
Omim ID
606249Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytoplasmic serine-threonine kinase that contains cysteine in place of the lysine found at the conserved ATP-binding location in subdomain II of protein kinases. Since this protein does have kinase activity, it is possible that another lysine in the kinase subdomain I can substitute for the missing conserved lysine. [provided by RefSeq
Other Designations
mitogen-activated protein kinase kinase kinase|protein kinase, lysine deficient 2|serologically defined colon cancer antigen 43
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com