C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
C8orf33 MaxPab rabbit polyclonal antibody. Western Blot analysis of C8orf33 expression in mouse liver.
Western Blot (Tissue lysate)
C8orf33 MaxPab rabbit polyclonal antibody. Western Blot analysis of C8orf33 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of C8orf33 expression in transfected 293T cell line (H00065265-T02) by C8orf33 MaxPab polyclonal antibody.
Lane 1: C8orf33 transfected lysate(25.30 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C8orf33 on HeLa cell. [antibody concentration 30 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C8orf33 protein.
Immunogen
C8orf33 (AAH10001.1, 1 a.a. ~ 229 a.a) full-length human protein.
Sequence
MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (78); Rat (64)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C8orf33 MaxPab rabbit polyclonal antibody. Western Blot analysis of C8orf33 expression in mouse liver.Western Blot (Tissue lysate)
C8orf33 MaxPab rabbit polyclonal antibody. Western Blot analysis of C8orf33 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of C8orf33 expression in transfected 293T cell line (H00065265-T02) by C8orf33 MaxPab polyclonal antibody.
Lane 1: C8orf33 transfected lysate(25.30 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C8orf33 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — C8orf33
Entrez GeneID
65265GeneBank Accession#
BC010001.1Protein Accession#
AAH10001.1Gene Name
C8orf33
Gene Alias
FLJ20989
Gene Description
chromosome 8 open reading frame 33
Gene Ontology
HyperlinkOther Designations
hypothetical protein LOC65265
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com