PYCRL monoclonal antibody (M01), clone 4F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PYCRL monoclonal antibody (M01), clone 4F11 Western Blot analysis of PYCRL expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PYCRL expression in transfected 293T cell line by PYCRL monoclonal antibody (M01), clone 4F11.
Lane 1: PYCRL transfected lysate (Predicted MW: 28.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PYCRL transfected lysate using anti-PYCRL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PYCRL monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PYCRL is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PYCRL on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PYCRL.
Immunogen
PYCRL (NP_075566, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PYCRL monoclonal antibody (M01), clone 4F11 Western Blot analysis of PYCRL expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PYCRL expression in transfected 293T cell line by PYCRL monoclonal antibody (M01), clone 4F11.
Lane 1: PYCRL transfected lysate (Predicted MW: 28.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PYCRL transfected lysate using anti-PYCRL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PYCRL monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PYCRL is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PYCRL on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PYCRL
-
Interactome
-
Pathway
-
Publication Reference
-
Functional specialization in proline biosynthesis of melanoma.
De Ingeniis J, Ratnikov B, Richardson AD, Scott DA, Aza-Blanc P, De SK, Kazanov M, Pellecchia M, Ronai Z, Osterman AL, Smith JW.
PLoS One 2012 Sep; 7(9):e45190.
Application：WB-Ce, Human, Human melanocytes, Lu1205 cells, Melanoma cells.
-
Functional specialization in proline biosynthesis of melanoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com