Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NOL6 (Human) Recombinant Protein (P01)

  • Catalog # : H00065083-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NOL6 full-length ORF ( AAH08298, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00065083-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NOL6
  • Gene Alias:
  • FLJ21959,MGC14896,MGC14921,MGC20838,NRAP,UTP22,bA311H10.1
  • Gene Description:
  • nucleolar protein family 6 (RNA-associated)
  • Gene Summary:
  • The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000449,OTTHUMP00000000450,OTTHUMP00000000451,OTTHUMP00000000452,nucleolar protein family 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook