VPS33A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
VPS33A MaxPab polyclonal antibody. Western Blot analysis of VPS33A expression in human pancreas.
Western Blot (Cell lysate)
VPS33A MaxPab polyclonal antibody. Western Blot analysis of VPS33A expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of VPS33A expression in transfected 293T cell line (H00065082-T01) by VPS33A MaxPab polyclonal antibody.
Lane 1: VPS33A transfected lysate(65.56 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VPS33A protein.
Immunogen
VPS33A (NP_075067.2, 1 a.a. ~ 596 a.a) full-length human protein.
Sequence
MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
VPS33A MaxPab polyclonal antibody. Western Blot analysis of VPS33A expression in human pancreas.Western Blot (Cell lysate)
VPS33A MaxPab polyclonal antibody. Western Blot analysis of VPS33A expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of VPS33A expression in transfected 293T cell line (H00065082-T01) by VPS33A MaxPab polyclonal antibody.
Lane 1: VPS33A transfected lysate(65.56 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — VPS33A
Entrez GeneID
65082GeneBank Accession#
NM_022916.4Protein Accession#
NP_075067.2Gene Name
VPS33A
Gene Alias
FLJ22395, FLJ23187
Gene Description
vacuolar protein sorting 33 homolog A (S. cerevisiae)
Omim ID
610034Gene Ontology
HyperlinkGene Summary
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and it encodes a protein similar to the yeast class C Vps33 protein. The mammalian class C VPS proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq
Other Designations
vacuolar protein sorting 33A
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com