MRPL1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MRPL1 MaxPab polyclonal antibody. Western Blot analysis of MRPL1 expression in human liver.
Western Blot (Cell lysate)
MRPL1 MaxPab polyclonal antibody. Western Blot analysis of MRPL1 expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of MRPL1 expression in transfected 293T cell line (H00065008-T01) by MRPL1 MaxPab polyclonal antibody.
Lane 1: MRPL1 transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to MRPL1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPL1 protein.
Immunogen
MRPL1 (AAH14356.1, 1 a.a. ~ 303 a.a) full-length human protein.
Sequence
MVYQTSLCSCSVNIRVPNRHFAAATKSAKKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MRPL1 MaxPab polyclonal antibody. Western Blot analysis of MRPL1 expression in human liver.Western Blot (Cell lysate)
MRPL1 MaxPab polyclonal antibody. Western Blot analysis of MRPL1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of MRPL1 expression in transfected 293T cell line (H00065008-T01) by MRPL1 MaxPab polyclonal antibody.
Lane 1: MRPL1 transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to MRPL1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MRPL1
Entrez GeneID
65008GeneBank Accession#
NM_020236.2Protein Accession#
AAH14356.1Gene Name
MRPL1
Gene Alias
BM022, FLJ96680, L1MT, MRP-L1
Gene Description
mitochondrial ribosomal protein L1
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L1 ribosomal protein family. [provided by RefSeq
Other Designations
39S ribosomal protein L1, mitochondrial|OTTHUMP00000160703
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com