METTL4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of METTL4 expression in transfected 293T cell line (H00064863-T01) by METTL4 MaxPab polyclonal antibody.
Lane1:METTL4 transfected lysate(51.92 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human METTL4 protein.
Immunogen
METTL4 (NP_073751.2, 1 a.a. ~ 472 a.a) full-length human protein.
Sequence
MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of METTL4 expression in transfected 293T cell line (H00064863-T01) by METTL4 MaxPab polyclonal antibody.
Lane1:METTL4 transfected lysate(51.92 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — METTL4
Entrez GeneID
64863GeneBank Accession#
NM_022840.2Protein Accession#
NP_073751.2Gene Name
METTL4
Gene Alias
FLJ23017, HsT661, MGC117235
Gene Description
methyltransferase like 4
Gene Ontology
HyperlinkOther Designations
-
-
Publication Reference
-
METTL4-mediated nuclear N6-deoxyadenosine methylation promotes metastasis through activating multiple metastasis-inducing targets.
Kai-Wen Hsu, Joseph Chieh-Yu Lai, Jeng-Shou Chang, Pei-Hua Peng, Ching-Hui Huang, Der-Yen Lee, Yu-Cheng Tsai, Chi-Jung Chung, Han Chang, Chao-Hsiang Chang, Ji-Lin Chen, See-Tong Pang, Ziyang Hao, Xiao-Long Cui, Chuan He, Kou-Juey Wu.
Genome Biology 2022 Dec; 23(1):249.
Application：IF, Human, BFTC909, FADU, KTCC28M cells.
-
METTL4-mediated nuclear N6-deoxyadenosine methylation promotes metastasis through activating multiple metastasis-inducing targets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com