Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AIDA MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00064853-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human AIDA protein.
  • Immunogen:
  • AIDA (NP_073742.2, 1 a.a. ~ 306 a.a) full-length human protein.
  • Sequence:
  • MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of AIDA transfected lysate using anti-AIDA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with C1orf80 MaxPab mouse polyclonal antibody (B01) (H00064853-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • AIDA
  • Gene Alias:
  • C1orf80,FLJ12806,FLJ32421,RP11-378J18.7
  • Gene Description:
  • axin interactor, dorsalization associated
  • Other Designations:
  • OTTHUMP00000035773,axin interaction partner and dorsalization antagonist
  • RSS
  • YouTube
  • Linkedin
  • Facebook