Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPS8L2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00064787-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EPS8L2 partial ORF ( NP_073609, 615 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00064787-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • EPS8L2
  • Gene Alias:
  • EPS8R2,FLJ16738,FLJ21935,FLJ22171,MGC126530,MGC3088
  • Gene Description:
  • EPS8-like 2
  • Gene Summary:
  • This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq
  • Other Designations:
  • EPS8-related protein 2,epidermal growth factor receptor pathway substrate 8-like protein 2,epidermal growth factor receptor pathway substrate 8-related protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook