EPS8L2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EPS8L2 partial ORF ( NP_073609, 615 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EPS8L2
Entrez GeneID
64787GeneBank Accession#
NM_022772Protein Accession#
NP_073609Gene Name
EPS8L2
Gene Alias
EPS8R2, FLJ16738, FLJ21935, FLJ22171, MGC126530, MGC3088
Gene Description
EPS8-like 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq
Other Designations
EPS8-related protein 2|epidermal growth factor receptor pathway substrate 8-like protein 2|epidermal growth factor receptor pathway substrate 8-related protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com