EPS8L2 monoclonal antibody (M01), clone 6C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EPS8L2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of EPS8L2 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
EPS8L2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of EPS8L2 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPS8L2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPS8L2.
Immunogen
EPS8L2 (NP_073609, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (85); Rat (84)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPS8L2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of EPS8L2 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
EPS8L2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of EPS8L2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPS8L2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — EPS8L2
Entrez GeneID
64787GeneBank Accession#
NM_022772Protein Accession#
NP_073609Gene Name
EPS8L2
Gene Alias
EPS8R2, FLJ16738, FLJ21935, FLJ22171, MGC126530, MGC3088
Gene Description
EPS8-like 2
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq
Other Designations
EPS8-related protein 2|epidermal growth factor receptor pathway substrate 8-like protein 2|epidermal growth factor receptor pathway substrate 8-related protein 2
-
Interactome
-
Publication Reference
-
Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.
Smalley DM, Sheman NE, Nelson K, Theodorescu D.
Journal of Proteome Research 2008 Mar; 7(5):2088.
Application：WB, Human, Urine microparticles from healthy controls and individuals with bladder cancer.
-
Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com