Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPS8L2 polyclonal antibody (A01)

  • Catalog # : H00064787-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EPS8L2.
  • Immunogen:
  • EPS8L2 (NP_073609, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00064787-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EPS8L2 polyclonal antibody (A01), Lot # 060614JCS1. Western Blot analysis of EPS8L2 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EPS8L2 polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of EPS8L2 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EPS8L2
  • Gene Alias:
  • EPS8R2,FLJ16738,FLJ21935,FLJ22171,MGC126530,MGC3088
  • Gene Description:
  • EPS8-like 2
  • Gene Summary:
  • This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. [provided by RefSeq
  • Other Designations:
  • EPS8-related protein 2,epidermal growth factor receptor pathway substrate 8-like protein 2,epidermal growth factor receptor pathway substrate 8-related protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook