Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLJ13912 (Human) Recombinant Protein (P01)

  • Catalog # : H00064785-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FLJ13912 full-length ORF ( AAH05879, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 49.28
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00064785-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • GINS3
  • Gene Alias:
  • FLJ13912,PSF3
  • Gene Description:
  • GINS complex subunit 3 (Psf3 homolog)
  • Gene Summary:
  • This gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • GINS complex subunit 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook