Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IPPK polyclonal antibody (A01)

  • Catalog # : H00064768-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IPPK.
  • Immunogen:
  • IPPK (NP_073592, 391 a.a. ~ 491 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00064768-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • IPPK
  • Gene Alias:
  • C9orf12,FLJ13163,INSP5K2,IP5K,IPK1,KIAA0699,bA476B13.1
  • Gene Description:
  • inositol 1,3,4,5,6-pentakisphosphate 2-kinase
  • Other Designations:
  • 1,3,4,5,6-pentakisphosphate 2-kinase,OTTHUMP00000021662,bA476B13.1 (novel protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook