ACBD3 monoclonal antibody (M01), clone 2G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Immunogen
ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACBD3 monoclonal antibody (M01), clone 2G2 Western Blot analysis of ACBD3 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
ACBD3 monoclonal antibody (M01), clone 2G2. Western Blot analysis of ACBD3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody (M01), clone 2G2.
Lane 1: ACBD3 transfected lysate(60.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACBD3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ACBD3
Entrez GeneID
64746GeneBank Accession#
NM_022735Protein Accession#
NP_073572Gene Name
ACBD3
Gene Alias
GCP60, GOCAP1, GOLPH1, PAP7
Gene Description
acyl-Coenzyme A binding domain containing 3
Omim ID
606809Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq
Other Designations
OTTHUMP00000035668|PBR associated protein|PKA (RIalpha)-associated protein|golgi complex associated protein 1, 60kDa|golgi phosphoprotein 1|golgi resident protein GCP60|peripherial benzodiazepine receptor associated protein
-
Interactome
-
Disease
-
Publication Reference
-
Searching for cellular partners of hantaviral nonstructural protein NSs: Y2H screening of mouse cDNA library and analysis of cellular interactome.
Rönnberg T, Jääskeläinen K, Blot G, Parviainen V, Vaheri A, Renkonen R, Bouloy M, Plyusnin A.
PLoS One 2012 Apr; 7(4):e34307.
Application:TR-FRET, Mouse, Kidney cells harvested from common vole (Microtus arvalis), the natural host for TULV.
-
Searching for cellular partners of hantaviral nonstructural protein NSs: Y2H screening of mouse cDNA library and analysis of cellular interactome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com