Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACBD3 polyclonal antibody (A01)

  • Catalog # : H00064746-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ACBD3.
  • Immunogen:
  • ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00064746-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACBD3 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of ACBD3 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACBD3 polyclonal antibody (A01), Lot # 061025JCS1. Western Blot analysis of ACBD3 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACBD3 polyclonal antibody (A01), Lot # 061025JCS1 Western Blot analysis of ACBD3 expression in A-431 ( Cat # L015V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ACBD3
  • Gene Alias:
  • GCP60,GOCAP1,GOLPH1,PAP7
  • Gene Description:
  • acyl-Coenzyme A binding domain containing 3
  • Gene Summary:
  • The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035668,PBR associated protein,PKA (RIalpha)-associated protein,golgi complex associated protein 1, 60kDa,golgi phosphoprotein 1,golgi resident protein GCP60,peripherial benzodiazepine receptor associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook