WDR13 monoclonal antibody (M03), clone 1G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WDR13.
Immunogen
WDR13 (NP_060353.2, 391 a.a. ~ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVERAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRREQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR13 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — WDR13
Entrez GeneID
64743GeneBank Accession#
NM_017883Protein Accession#
NP_060353.2Gene Name
WDR13
Gene Alias
DKFZp779C2057, FLJ20563, MG21
Gene Description
WD repeat domain 13
Omim ID
300512Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000025798|OTTHUMP00000025799|WD repeat domain 13 protein|located at OATL1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com