Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GORASP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00064689-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GORASP1 partial ORF ( NP_114105, 341 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00064689-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • GORASP1
  • Gene Alias:
  • FLJ23443,GOLPH5,GRASP65,MGC118894,MGC118897,P65
  • Gene Description:
  • golgi reassembly stacking protein 1, 65kDa
  • Gene Summary:
  • The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined. [provided by RefSeq
  • Other Designations:
  • Golgi peripheral membrane protein p65,Golgi phosphoprotein 5,Golgi reassembly and stacking protein 1,Golgi reassembly and stacking protein, 65 kDa,Golgi reassembly stacking protein 1,OTTHUMP00000161966
  • RSS
  • YouTube
  • Linkedin
  • Facebook