GORASP1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GORASP1 partial ORF ( NP_114105, 341 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SGPEDICSSSSSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GORASP1
Entrez GeneID
64689GeneBank Accession#
NM_031899Protein Accession#
NP_114105Gene Name
GORASP1
Gene Alias
FLJ23443, GOLPH5, GRASP65, MGC118894, MGC118897, P65
Gene Description
golgi reassembly stacking protein 1, 65kDa
Omim ID
606867Gene Ontology
HyperlinkGene Summary
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined. [provided by RefSeq
Other Designations
Golgi peripheral membrane protein p65|Golgi phosphoprotein 5|Golgi reassembly and stacking protein 1|Golgi reassembly and stacking protein, 65 kDa|Golgi reassembly stacking protein 1|OTTHUMP00000161966
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com