Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC7A MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00064581-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CLEC7A protein.
  • Immunogen:
  • CLEC7A (NP_922945, 1 a.a. ~ 77 a.a) full-length human protein.
  • Sequence:
  • MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CLEC7A expression in transfected 293T cell line (H00064581-T02) by CLEC7A MaxPab polyclonal antibody.

    Lane 1: CLEC7A transfected lysate(8.47 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CLEC7A
  • Gene Alias:
  • BGR,CLECSF12,DECTIN1
  • Gene Description:
  • C-type lectin domain family 7, member A
  • Gene Summary:
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq
  • Other Designations:
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12,beta-glucan receptor,dectin-1,dendritic cell-associated C-type lectin 1,dendritic cell-associated C-type lectin-1,lectin-like receptor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook