Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HHIP (Human) Recombinant Protein (Q01)

  • Catalog # : H00064399-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HHIP partial ORF ( NP_071920, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00064399-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HHIP
  • Gene Alias:
  • FLJ20992,FLJ90230,HIP,STQTL12
  • Gene Description:
  • hedgehog interacting protein
  • Gene Summary:
  • This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq
  • Other Designations:
  • hedgehog-interacting protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook